HPA005980

LRP2 antibody from Sigma-Aldrich
DBS, gp330
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005980
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005980, RRID:AB_1079278
Product name
Anti-LRP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005980
Antibody type
Polyclonal
Antigen
Low-density lipoprotein receptor-related protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNL
SSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYT
VRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLK
YVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGR
YRKWLISTDL
Storage
-20C
Provider Type Product Number
- No reagents -