HPA013209

GPR78 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013209
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013209, RRID:AB_10601657
Product name
Anti-GPR78 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013209
Antibody type
Polyclonal
Antigen
G protein-coupled receptor 78 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLAELVPFVTVNAQWGILSKCLTYSKAVADPFTYS
LLRRPFRQVLAGMVHRLLKRTPRPASTHDSSLDVA
GMVHQLLKRTPRPASTHNGSVDTENDSCLQQTH
Storage
-20C
Provider Type Product Number
- No reagents -