HPA002318

GLDC antibody from Atlas Antibodies
GCSP, NKH
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA002318
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002318, RRID:AB_1668990
Product name
Anti-GLDC
Provider product page
Atlas Antibodies - HPA002318
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ILNANYMAKRLETHYRILFRGARGYVGHEFILDTR
PFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTL
MVEPTESEDKAELDRFCDAMISIRQEIADIEEGRI
DPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPL
PFVKPENK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -