HPA002318

GLDC antibody from Atlas Antibodies
GCSP, NKH
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002318
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002318, RRID:AB_1849700
Product name
Anti-GLDC
Provider product page
Atlas Antibodies - HPA002318
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ILNANYMAKRLETHYRILFRGARGYVGHEFILDTR
PFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTL
MVEPTESEDKAELDRFCDAMISIRQEIADIEEGRI
DPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPL
PFVKPENK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -