Antibody data

Product number
H00000081-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000081-M01A, RRID:AB_10662142
Product name
ACTN4 monoclonal antibody (M01A), clone 4D10
Provider product page
Abnova Corporation - H00000081-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ACTN4.
Antigen sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKV
QQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVV
GPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERS
IVDYK
Isotype
IgG
Antibody clone number
4D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -