HPA001873

ACTN4 antibody from Sigma-Aldrich
FSGS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001873, RRID:AB_1078096
Product name
Anti-ACTN4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001873
Antibody type
Polyclonal
Antigen
alpha-Actinin-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFIVHTIEEIEGLISAHDQFKSTLPDADREREAIL
AIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKW
EKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQA
NVVGPWIQTKMEEIGRISIEMNGTLE
Storage
-20C
Provider Type Product Number
- No reagents -