Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004957-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004957-M01, RRID:AB_1137338
- Product name
- ODF2 monoclonal antibody (M01), clone 1A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ODF2.
- Antigen sequence
KEHALSKERAAQNKILDLETQLSRTKTELSQLRRS
RDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQF
LKSSYANVFGDGPYSTFLTSSPIRSRSPP- Isotype
- IgG
- Antibody clone number
- 1A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PIPKIγ targets to the centrosome and restrains centriole duplication.
Xu Q, Zhang Y, Xiong X, Huang Y, Salisbury JL, Hu J, Ling K
Journal of cell science 2014 Mar 15;127(Pt 6):1293-305
Journal of cell science 2014 Mar 15;127(Pt 6):1293-305
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ODF2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol