H00004957-M01

ODF2 antibody from Abnova Corporation
CT134, ODF84

Antibody data

Product number
H00004957-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004957-M01, RRID:AB_1137338
Product name
ODF2 monoclonal antibody (M01), clone 1A1
Provider product page
Abnova Corporation - H00004957-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ODF2.
Antigen sequence
KEHALSKERAAQNKILDLETQLSRTKTELSQLRRS
RDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQF
LKSSYANVFGDGPYSTFLTSSPIRSRSPP
Isotype
IgG
Antibody clone number
1A1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -