HPA001874

ODF2 antibody from Atlas Antibodies
CT134, ODF84
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001874
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001874, RRID:AB_888703
Product name
Anti-ODF2
Provider product page
Atlas Antibodies - HPA001874
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSE
KLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMN
AVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAH
ELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQ
EKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -