HPA020463

NDUFV3 antibody from Sigma-Aldrich
CI-10k
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020463
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020463, RRID:AB_1854358
Product name
Anti-NDUFV3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020463
Antibody type
Polyclonal
Antigen
NADH dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVVSKGRGGLRKPEASHSFENRAPRVTVSAKEKTL
LQKPHVDITDPEKPHQPKKKGSPAKPSEGRENARP
KTTMPRSQVDEEFLKQSLKEKQLQKTFRLNEIDKE
SQKPFEVKGPLPVHTKSGLSA
Storage
-20C
Provider Type Product Number
- No reagents -