HPA030427

NDUFV3 antibody from MilliporeSigma / Merck KGaA
CI-10k
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030427
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030427, RRID:AB_10603024
Product name
Anti-NDUFV3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030427
Antibody type
Polyclonal
Antigen
NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSP
PKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNL
ELSKFRMP
Storage
-20C
Provider Type Product Number
- No reagents -