HPA018892

HSPG2 antibody from MilliporeSigma / Merck KGaA
perlecan, PRCAN, SJS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018892
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018892, RRID:AB_1850597
Product name
Anti-HSPG2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018892
Antibody type
Polyclonal
Antigen
Basement membrane-specific heparan sulfate proteoglycan core protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNPQRNSRLTGEFTVEPVPEGAQLSFGNFAQLGHE
SFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGS
PLSDPDVQITGNNIMLVASQPALQGPERRSYEIMF
RE
Storage
-20C
Provider Type Product Number
- No reagents -