Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006781-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006781-M01, RRID:AB_464349
- Product name
- STC1 monoclonal antibody (M01), clone 4H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STC1.
- Antigen sequence
NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTV
STIRDSLMEKIGPNMASLFHILQTDHCAQTHPRAD
FNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHE
SA- Isotype
- IgG
- Antibody clone number
- 4H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human stanniocalcin-1 interacts with nuclear and cytoplasmic proteins and acts as a SUMO E3 ligase.
dos Santos MT, Trindade DM, Gonçalves Kde A, Bressan GC, Anastassopoulos F, Yunes JA, Kobarg J
Molecular bioSystems 2011 Jan;7(1):180-93
Molecular bioSystems 2011 Jan;7(1):180-93
No comments: Submit comment
No validations: Submit validation data