Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009022-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009022-M02, RRID:AB_530005
- Product name
- CLIC3 monoclonal antibody (M02), clone 3F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CLIC3.
- Antigen sequence
RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTL
ADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYL
DSAMQEKEFKYTCPHSAEILAAYRPAVHPR- Isotype
- IgG
- Antibody clone number
- 3F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CLIC3 monoclonal antibody (M02), clone 3F8 Western Blot analysis of CLIC3 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CLIC3 expression in transfected 293T cell line by CLIC3 monoclonal antibody (M02), clone 3F8.Lane 1: CLIC3 transfected lysate(26.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CLIC3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CLIC3 on HeLa cell. [antibody concentration 15 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CLIC3 transfected lysate using anti-CLIC3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CLIC3 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CLIC3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CLIC3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol