HPA003412

PLAT antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003412
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003412, RRID:AB_1858205
Product name
Anti-PLAT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003412
Antibody type
Polyclonal
Antigen
Tissue-type plasminogen activator precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTE
SGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNY
CRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGL
RQYSQPQFRIKGGLF
Storage
-20C
Provider Type Product Number
- No reagents -