Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064236-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064236-B01P, RRID:AB_1237922
- Product name
- PDLIM2 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human PDLIM2 protein.
- Antigen sequence
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAER
GKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIR
QSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQ
GSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPP
SSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGR
PGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSE
GGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLL
QEALEAEERGGTPAFLPSSLSPQSSLPASRALATP
PKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCAD
CGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSS
RA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human T-cell leukemia virus type 1 bZIP factor selectively suppresses the classical pathway of NF-kappaB.
Zhao T, Yasunaga J, Satou Y, Nakao M, Takahashi M, Fujii M, Matsuoka M
Blood 2009 Mar 19;113(12):2755-64
Blood 2009 Mar 19;113(12):2755-64
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PDLIM2 expression in transfected 293T cell line (H00064236-T01) by PDLIM2 MaxPab polyclonal antibody.Lane 1: PDLIM2 transfected lysate(38.72 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PDLIM2 MaxPab polyclonal antibody. Western Blot analysis of PDLIM2 expression in human liver.